James is drawing a model that illustrates how magnetic reversal supports the theory of seafloor spreading and plate tectonics. How should James label the parts of the model indicated by the arrows labeled A, B, C, and D?James is drawing a model that illustrates how magnetic reversal supports the theory of seafloor spreading and plate tectonics. How should James label the parts of the model indicated by the arrows labeled A, B, C, and D?
A: "A: N, B: N, C: S, D: N"
B:"A: N, B: N, C: S, D: S"
C: "A: S, B: N, C: S, D: S"
D:"A: S, B: S, C: N, D: N"

Question

atomflc2008 atomflc2008

02-05-2022
Advanced Placement (AP)

Answered

At Westonci.ca, we connect you with experts who provide detailed answers to your most pressing questions. Start exploring now! Connect with professionals ready to provide precise answers to your questions on our comprehensive Q&A platform. Our platform offers a seamless experience for finding reliable answers from a network of knowledgeable professionals.

James is drawing a model that illustrates how magnetic reversal supports the theory of seafloor spreading and plate tectonics. How should James label the parts of the model indicated by the arrows labeled A, B, C, and D?James is drawing a model that illustrates how magnetic reversal supports the theory of seafloor spreading and plate tectonics. How should James label the parts of the model indicated by the arrows labeled A, B, C, and D?
A: "A: N, B: N, C: S, D: N"
B:"A: N, B: N, C: S, D: S"
C: "A: S, B: N, C: S, D: S"
D:"A: S, B: S, C: N, D: N"

Sagot :

Thank you for trusting us with your questions. We're here to help you find accurate answers quickly and efficiently. Thank you for your visit. We're dedicated to helping you find the information you need, whenever you need it. Westonci.ca is committed to providing accurate answers. Come back soon for more trustworthy information.

The haccp system incorporates sensible manufacturing processes, sanitation standards, and personal hygiene. a. false b. true

In the context of core principles of data protection for public health (section 2.2 of the document), which term below best matches the following definition: "a

Donald, a wealthy businessman, would like to open up a new business in seattle, washington. he claims he has a constitutional right to enter other states and co

The function f is defined as follows.f(x) = x² +9If the graph of f is translated vertically downward by 4 units, it becomes the graph of a function g.Find the e

The first few amino acids of the protein hemoglobin are given below: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALT How many alpha helices

The diameter of a cylindrical construction pipe is 5 ft. If the pipe is 27 ft long, what is its volume?Use the value 3.14 for л, and round your answer to the ne

the three-number bet (a) Find the expected value of each $1 bet in roulette.

Priya is buying raisins and almonds to make trail mix. Almonds cost $5.20 per pound and raisins cost $2.75 per pound. Priya spent $11.70 buying almonds and rais

Explain how the scope of a theory influences its usefulness and application to the social world (think micro vs macro).

The atmospheric component that contributes to the majority of greenhouse warming on Earth is: O nitrous oxide. O ozone. O water vapor. O carbon dioxide. O metha

shrutiagrawal1798 shrutiagrawal1798 · Answer 1 · 2022-05-06T01:40:31-04:00

The movement of the seafloor and the tectonic plates has been responsible for the movement of the continents. The arrows in the model can be represented as "A: S, B: S, C: N, D: N"

What are tectonic plates?

The big pieces of the earth's lithosphere that move is termed the tectonic plates. The movement of the plates has been given as the theory for the formation of the continents, as well as the cause of various disasters, including earthquakes and volcanos.

The model representing the movement of the plates from the center can be given in the N and the S direction. Thus, the representation of the arrows in the model will be: "A: S, B: S, C: N, D: N"

Learn more about tectonic plates, here:

https://brainly.com/question/16944828

#SPJ1

Sagot :

What are tectonic plates?

Other Questions