The first few amino acids of the protein hemoglobin are given below: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALT How many alpha helices would you predict here? Show your predictions! Remember that proline CANNOT be in an alpha helix and are typically found at the ends of helices. Glycine can be in a helix, but only up to twice in any one helix. Use the propensity table above to give your best answer.

Question

06-06-2024
Chemistry

Answered

Discover answers to your questions with Westonci.ca, the leading Q&A platform that connects you with knowledgeable experts. Explore thousands of questions and answers from a knowledgeable community of experts ready to help you find solutions. Our platform provides a seamless experience for finding reliable answers from a network of experienced professionals.

The first few amino acids of the protein hemoglobin are given below: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALT How many alpha helices would you predict here? Show your predictions! Remember that proline CANNOT be in an alpha helix and are typically found at the ends of helices. Glycine can be in a helix, but only up to twice in any one helix. Use the propensity table above to give your best answer.

Sagot :

Thanks for stopping by. We strive to provide the best answers for all your questions. See you again soon. Thank you for your visit. We're dedicated to helping you find the information you need, whenever you need it. Thank you for visiting Westonci.ca, your go-to source for reliable answers. Come back soon for more expert insights.

Gregorian Chant is named after Pope Gregory I, who Group of answer choices organized a group of composers to write a new set of plainchant melodies. had his nam

who still uses this to talk to random people

Jason is traveling by car from his home to his office. He has gone 3.5 miles so far. From this point on, he can cover 100 miles every 2 hours. What is the equat

Complete the steps to solve the inequality: 0.2(x + 20) – 3 > –7 – 6.2x Use the distributive property: Combine like terms: Use the addition property of inequ

4. Do you believe McCandless is to blame for his own death? Explain your answer using two specific details from the chapter. Use quotations to support your resp

The true value was 0.120. What was your percent error?

Once upon a time, there was a weak little man, lived with his (a) ________ (noun) in a (b) __________ (adjective) house on the edge of a dark wood. Although he

Cinco estudiantes tienen x canicas cada uno. Cuando reúnen todos sus canicas, la cantidad reunida es menor que 45

Ali is hiking on the hill, whose height is given by f(u,v)=n^2 e^((u+n)/(v+n)). Currently, he is positioned at point (3, 5). Find the direction at which he move

How does the following statement in the Declaration of Independence support the conclusion that America must form its own government? Prudence, indeed, will dic

grimm0047 grimm0047 · Answer 1 · 2024-06-06T00:51:42-04:00

To predict alpha helices in the hemoglobin sequence:

1. Identify Proline Residues:
- Proline (P) cannot be in an alpha helix: found at positions 4, 23, and 48.

2. Identify Glycine Residues:
- Glycine (G) can be in an alpha helix but typically no more than twice per helix: found at positions 16, 17, 25, 26, 35, 50, 51, and 55.

Predicted Alpha Helices:
1. First Helix: From the start (M1) to L3 (before P4).
2. Second Helix: From D6 to G17 (no prolines and acceptable glycine count).
3. Third Helix: From A28 to T47 (no prolines and acceptable glycine count).

Thus, there are three predicted alpha helices in the sequence:

1. M1-L3
2. D6-G17
3. A28-T47

Sagot :

Other Questions